PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094536.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 281aa    MW: 30317.9 Da    PI: 6.9928
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094536.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1177.3e-371468761
          zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvP+Ggg+rk+++ 
  XP_011094536.1 14 ACPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPIGGGCRKSRRG 68
                    7**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-20157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5181367IPR003851Zinc finger, Dof-type
PfamPF027012.2E-311467IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MERGWKPNVE VSPACPRCGS SNTKFCYYNN YSLTQPRYFC KGCRRYWTKG GSLRNVPIGG  60
GCRKSRRGKS IRLPADGGVG SRALVRHGIE SSSSNSAGPS ADSSTSIDLA AVYANYLNQT  120
PRLENQIEAV SHLPDGIGIP PVEFSNFHMN QLTSHLPQES GFFECGPFPN RFSGNQLLGD  180
GNSIFLGGLE PFQKQQVTFS GNNFSSINPI DNLPPLPGED VGPADGILWP GSDVILPNQL  240
ILPSTTHEMA PAVEPAGQNS EMLNGNVSPF TALNLEAIFR S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094536.10.0PREDICTED: dof zinc finger protein DOF3.5
SwissprotQ9SVC54e-45DOF35_ARATH; Dof zinc finger protein DOF3.5
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129631317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.13e-33Dof family protein